Danish
Uniprot ID:  Q0DI31
  • Protein: Cytochrome c
  • Organism: Rice (Oryza sativa subsp. japonica)
  • Length: 112
  • Sequence:
    • MASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKNMAVIWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00001ccr , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-111 (2-112), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) M1X, N61D
Insertions None
Deletions None
Sequence identity to UniProt 0.9821
auth_asym_id A
Missing residues 80LYS-80LYS:94LYS-94LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å