Danish
Uniprot ID:  Q0P815
  • Protein: Pyridoxamine 5'-phosphate oxidase
  • Organism: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
  • Length: 251
  • Sequence:
    • MNFESIISHMNDHHKSNLVDLCKKFGGIEQVQDVFLKSVDFNGLDLVYNDKENLRVEFPKKADENTIKDAIISLCMSAKSEQNFSGVEKELNEFMLSFNSVALATLNANGEVVCSYAPFVSTQWGNYIYISEVSEHFNNIKVNPNNIEIMFLEDESKAVSVILRKRLRYRVNASFLERGERFDQIYDEFEKQTGGEGGIKTIRKMLDFHLVKLEFKKGRFVKGFGQAYDIENGNVAHVGASGNPHKFLHKH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00003swj , Chain A 
Resolution 2.41 Å
Residue indices (Uniprot), coverage 2-251 (1-251), 1.00
Mutations (UniProt numbering) A70T, V159A, A236T
Insertions None
Deletions None
Sequence identity to UniProt 0.9880
auth_asym_id A
Missing residues 33ASP-33ASP:49ASN-51LYS
Structural gaps Exists
label_asym_ids of heme D ,  B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å