Danish
Uniprot ID:  Q0P842
  • Protein: Single domain haemoglobin
  • Organism: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
  • Length: 140
  • Sequence:
    • MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00002wy4 , Chain A 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 2-140 (1-140), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB