Danish
Uniprot ID:  Q0PB48
  • Protein: Group 3 truncated hemoglobin ctb
  • Organism: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
  • Length: 127
  • Sequence:
    • MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAIGTSDEEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNMLYKYGGH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002ig3 , Chain A 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 1-127 (1-127), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002ig3 , Chain B 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 1-124 (1-127), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme M
Available structure PDB