Danish
Uniprot ID:  Q12W16
  • Protein: Cytochrome b5-domain protein
  • Organism: Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
  • Length: 77
  • Sequence:
    • MEEFTTEELAKYNGKDGEKCYFAYKGKVYDVTESMLWEDGDHQGMHEGGIDLTADHEDAPHDDDVLEDFPVVGTLKA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00006vz6 , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 0-76 (1-77), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insA
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB