Danish
Uniprot ID:  Q16696
  • Protein: Cytochrome P450 2A13
  • Organism: Human (Homo sapiens)
  • Length: 494
  • Sequence:
    • MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  43
PDB ID:  pdb_00002pg5 , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 31-494 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240L, N297Q, F300I, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00002pg5 , Chain B 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 32-495 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240L, N297Q, F300I, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002pg5 , Chain C 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 32-494 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240L, N297Q, F300I, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00002pg5 , Chain D 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 31-494 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240L, N297Q, F300I, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004eji , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002p85 , Chain A 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (23-494), 0.96
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002p85 , Chain B 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (23-494), 0.96
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00002p85 , Chain C 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (23-494), 0.96
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00002p85 , Chain D 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (23-494), 0.96
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id D
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00002p85 , Chain E 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (23-494), 0.96
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id E
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00002p85 , Chain F 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (23-494), 0.96
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id F
label_asym_ids of heme V
Available structure PDB
PDB ID:  pdb_00004ejh , Chain A 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00004ejh , Chain B 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004ejh , Chain C 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00004ejh , Chain D 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00004ejh , Chain E 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id E
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00004ejh , Chain F 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id F
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00004ejh , Chain G 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 32-494 (31-494), 0.96
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id G
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00004ejh , Chain H 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 32-494 (31-494), 0.96
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id H
Missing residues 140VAL-143ARG
Structural gaps Exists
label_asym_ids of heme W
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004ejg , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00004ejg , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004ejg , Chain C 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00004ejg , Chain D 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 30-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00004ejg , Chain E 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 30-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id E
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00004ejg , Chain F 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 30-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id F
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00004ejg , Chain G 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 32-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id G
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00004ejg , Chain H 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 32-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id H
Missing residues 139GLY-143ARG
Structural gaps Exists
label_asym_ids of heme T
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00002pg6 , Chain A 
Resolution 2.53 Å
Residue indices (Uniprot), coverage 30-494 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240C, N297Q, F300I, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00002pg6 , Chain B 
Resolution 2.53 Å
Residue indices (Uniprot), coverage 32-495 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240C, N297Q, F300I, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002pg6 , Chain C 
Resolution 2.53 Å
Residue indices (Uniprot), coverage 31-494 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240C, N297Q, F300I, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002pg6 , Chain D 
Resolution 2.53 Å
Residue indices (Uniprot), coverage 31-494 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240C, N297Q, F300I, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id D
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00002pg7 , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 31-494 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240L, N297Q, F300V, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00002pg7 , Chain B 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 32-495 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240L, N297Q, F300V, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002pg7 , Chain C 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 31-494 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240L, N297Q, F300V, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002pg7 , Chain D 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 31-494 (29-494), 0.96
Difference from Uniprot sequence cloning artifact:engineered mutation:expression tag:variant
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K, K88R, L110V, A117V, G137D, H164G, E194K, S208I, A213S, K239Q, E240L, N297Q, F300V, A301G, T352M, M365V, L366I, G369S, H372R, N375K, F392Y, R403S, R409Q, D418N, K419E, Y438N, I456V, F462L, P465S
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9280
auth_asym_id D
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003t3s , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003t3s , Chain B 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003t3s , Chain C 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003t3s , Chain D 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00003t3s , Chain E 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id E
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00003t3s , Chain F 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id F
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00003t3s , Chain G 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id G
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00003t3s , Chain H 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 31-494 (31-494), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W24A, R25K, Q26K, R27T, K28S, R30K
Insertions 494insHHHH
Deletions L2-V23
Sequence identity to UniProt 0.9873
auth_asym_id H
label_asym_ids of heme V
Available structure PDB