Danish
Uniprot ID:  Q17091
  • Protein: Cytochrome b5
  • Organism: Pig roundworm (Ascaris suum)
  • Length: 112
  • Sequence:
    • MAFISSSRIHWLYIALSLMTILISQNLAMACGDKKYTKEEVAKHNTQNDLWIIYDGEVHDMTSFYKEHPGGKVILNKAGQDATSVLKTLAPHVKAADVVMKKLKQTCIGKVK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001x3x , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-82 (31-112), 0.73
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A30
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001x3x , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-82 (31-112), 0.73
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A30
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB