Danish

Uniprot ID: Q1LK00

Protein: Tryptophan 2,3-dioxygenase
Organism: Ralstonia metallidurans (Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34))
Length: 299
Sequence:

MSEFKGCPMGHGAAPQNGDGGDSGDTGNGWHGAQMDFARDMSYGDYLGLDQILSAQHPLSPDHNEMLFIVQHQTTELWMKLMLHELRAARDGVKSDQLQPAFKMLARVSRIMDQLVQAWNVLATMTPPEYSAMRPYLGASSGFQSYQYREIEFILGNKNAAMLRPHAHRPEHLELVETALHTPSMYDEAIRLMARRGFQIDPEVVERDWTQPTQYNASVEAAWLEVYRNPSAHWELYELGEKFVDLEDAFRQWRFRHVTTVERVIGFKRGTGGTEGVSYLRRMLDVVLFPELWKLRTDL

Number of chains: 16

PDB ID: pdb_00002nox , Chain A
Resolution	2.40 Å
Residue indices (Uniprot), coverage	39-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	A
label_asym_ids of heme	Q
Available structure	PDB

PDB ID: pdb_00002nox , Chain B
Resolution	2.40 Å
Residue indices (Uniprot), coverage	30-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	B
Missing residues	271THR-274THR
Structural gaps	Exists
label_asym_ids of heme	R
Available structure	PDB and Modeled
RMSD of experimental residues after energy minimization	0.13 Å

PDB ID: pdb_00002nox , Chain C
Resolution	2.40 Å
Residue indices (Uniprot), coverage	40-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	C
Missing residues	268LYS-272GLY
Structural gaps	Exists
label_asym_ids of heme	S
Available structure	PDB and Modeled
RMSD of experimental residues after energy minimization	0.13 Å

PDB ID: pdb_00002nox , Chain D
Resolution	2.40 Å
Residue indices (Uniprot), coverage	41-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	D
label_asym_ids of heme	T
Available structure	PDB

PDB ID: pdb_00002nox , Chain E
Resolution	2.40 Å
Residue indices (Uniprot), coverage	39-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	E
Missing residues	270GLY-274THR
Structural gaps	Exists
label_asym_ids of heme	U
Available structure	PDB and Modeled
RMSD of experimental residues after energy minimization	0.10 Å

PDB ID: pdb_00002nox , Chain F
Resolution	2.40 Å
Residue indices (Uniprot), coverage	35-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	F
Missing residues	270GLY-274THR
Structural gaps	Exists
label_asym_ids of heme	V
Available structure	PDB and Modeled
RMSD of experimental residues after energy minimization	0.13 Å

PDB ID: pdb_00002nox , Chain G
Resolution	2.40 Å
Residue indices (Uniprot), coverage	40-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	G
Missing residues	270GLY-270GLY
Structural gaps	Exists
label_asym_ids of heme	W
Available structure	PDB and Modeled
RMSD of experimental residues after energy minimization	0.12 Å

PDB ID: pdb_00002nox , Chain H
Resolution	2.40 Å
Residue indices (Uniprot), coverage	41-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	H
label_asym_ids of heme	X
Available structure	PDB

PDB ID: pdb_00002nox , Chain I
Resolution	2.40 Å
Residue indices (Uniprot), coverage	41-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	I
label_asym_ids of heme	Y
Available structure	PDB

PDB ID: pdb_00002nox , Chain J
Resolution	2.40 Å
Residue indices (Uniprot), coverage	39-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	J
Missing residues	269ARG-272GLY
Structural gaps	Exists
label_asym_ids of heme	Z
Available structure	PDB and Modeled
RMSD of experimental residues after energy minimization	0.13 Å

PDB ID: pdb_00002nox , Chain K
Resolution	2.40 Å
Residue indices (Uniprot), coverage	39-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	K
Missing residues	268LYS-273GLY
Structural gaps	Exists
label_asym_ids of heme	AA
Available structure	PDB and Modeled
RMSD of experimental residues after energy minimization	0.13 Å

PDB ID: pdb_00002nox , Chain L
Resolution	2.40 Å
Residue indices (Uniprot), coverage	40-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	L
label_asym_ids of heme	BA
Available structure	PDB

PDB ID: pdb_00002nox , Chain M
Resolution	2.40 Å
Residue indices (Uniprot), coverage	40-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	M
Missing residues	270GLY-274THR
Structural gaps	Exists
label_asym_ids of heme	CA
Available structure	PDB and Modeled
RMSD of experimental residues after energy minimization	0.13 Å

PDB ID: pdb_00002nox , Chain N
Resolution	2.40 Å
Residue indices (Uniprot), coverage	40-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	N
label_asym_ids of heme	DA
Available structure	PDB

PDB ID: pdb_00002nox , Chain O
Resolution	2.40 Å
Residue indices (Uniprot), coverage	39-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	O
Missing residues	269ARG-272GLY
Structural gaps	Exists
label_asym_ids of heme	EA
Available structure	PDB and Modeled
RMSD of experimental residues after energy minimization	0.12 Å

PDB ID: pdb_00002nox , Chain P
Resolution	2.40 Å
Residue indices (Uniprot), coverage	41-299 (19-299), 0.94
Mutations (UniProt numbering)	None
Insertions	None
Deletions	M1-G18
Sequence identity to UniProt	1.0000
auth_asym_id	P
label_asym_ids of heme	FA
Available structure	PDB