Danish

Uniprot ID: Q1PZE6

Protein: Hypothetical (Diheme) protein
Organism:
Length: 316
Sequence:

MNKTMLKIVAFGVAVIGFYMYITVYVTGLSGTGGGGTATGVSAEAGEQIFWGDGQCSTCHKIGSSGSATRGPDQEGLAERAEERAKELGLSSGLEYLVESIIDPEKYVVEGFDKIMPRVYDPPIMLSREKILAVLAYLQSLGGEPDLDAIMKFKDKIPEASKTKVKPWVPPLAVTAEEGEQVFFDESLDVTCGKCHMVNGKGQKVGPELTGIGAIQTPQYFVESILEPSAVIVKGYETVFVITADGIPYNGLIKSDTEEELTLILEESGSVEEVVIPKDEIEDMKKQEVSIMPGNIGELLSVRQFYAVIEYLRSLK

Number of chains: 3

PDB ID: 7zs2 , Chain A
Resolution	1.12 Å
Residue indices (Uniprot), coverage	39-316 (1-316), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	F , G
Available structure	PDB

PDB ID: 7zs1 , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	39-316 (1-316), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	E , F
Available structure	PDB

PDB ID: 7zs0 , Chain A
Resolution	1.75 Å
Residue indices (Uniprot), coverage	39-316 (1-316), 1.00
auth_asym_id	A
label_asym_ids of heme	E , F
Available structure	PDB