Danish
Uniprot ID:  Q1PZE6
  • Protein: Hypothetical (Diheme) protein
  • Organism: Kuenenia stuttgartiensis
  • Length: 316
  • Sequence:
    • MNKTMLKIVAFGVAVIGFYMYITVYVTGLSGTGGGGTATGVSAEAGEQIFWGDGQCSTCHKIGSSGSATRGPDQEGLAERAEERAKELGLSSGLEYLVESIIDPEKYVVEGFDKIMPRVYDPPIMLSREKILAVLAYLQSLGGEPDLDAIMKFKDKIPEASKTKVKPWVPPLAVTAEEGEQVFFDESLDVTCGKCHMVNGKGQKVGPELTGIGAIQTPQYFVESILEPSAVIVKGYETVFVITADGIPYNGLIKSDTEEELTLILEESGSVEEVVIPKDEIEDMKKQEVSIMPGNIGELLSVRQFYAVIEYLRSLK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00007zs2 , Chain A 
Resolution 1.12 Å
Residue indices (Uniprot), coverage 39-316 (1-316), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M292H
Insertions None
Deletions None
Sequence identity to UniProt 0.9968
auth_asym_id A
label_asym_ids of heme F ,  G
Available structure PDB
PDB ID:  pdb_00007zs1 , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 39-316 (1-316), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M292C
Insertions None
Deletions None
Sequence identity to UniProt 0.9968
auth_asym_id A
label_asym_ids of heme F ,  E
Available structure PDB
PDB ID:  pdb_00009fbk , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 39-316 (1-316), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme H ,  G
Available structure PDB
PDB ID:  pdb_00007zs0 , Chain A 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 39-316 (1-316), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F ,  E
Available structure PDB