- Protein: Class I small soluble cyt c
- Organism:
- Length: 126
- Sequence:
MKLFRLKYVLPLIAGLGLSLTSTAWALNEHTAGDTTKSPYTIYAGLGFAVQESCYYCHGNGGKGTTEGLIFGVPDFTSTEFQSSMTDKQIIDHINKGKGKCPSYQGKMSPEMIEKMAGVVRNFAVK
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 27-126 (27-126), 0.79 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 27-126 (27-126), 0.79 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 27-126 (27-126), 0.79 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |