- Protein: Small soluble cyt c
- Organism:
- Length: 135
- Sequence:
MKLKKGILAGICAMVISGMASIGYGATQQEICKNMWDPFQSMRAVTGLMELTSGQCTQLSKDAAAILAGVKESHDSISVDKNYKVLNDEVAYHAANIDAAAKANDLEEVQVQFRRMTIACRNCHKIYKTEQRLVP
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 26-135 (26-135), 0.81 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 25-135 (26-135), 0.81 |
| Difference from Uniprot sequence | cloning artifact:engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 25-135 (26-135), 0.81 |
| Difference from Uniprot sequence | cloning artifact:engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |