Danish
Uniprot ID:  Q1Q7P4
  • Protein: Class IIb small soluble cyt c
  • Organism: Kuenenia stuttgartiensis
  • Length: 135
  • Sequence:
    • MKLKKGILAGICAMVISGMASIGYGATQQEICKNMWDPFQSMRAVTGLMELTSGQCTQLSKDAAAILAGVKESHDSISVDKNYKVLNDEVAYHAANIDAAAKANDLEEVQVQFRRMTIACRNCHKIYKTEQRLVP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00006r6m , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 26-135 (26-135), 0.81
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G25
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006r6o , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 25-135 (26-135), 0.82
Difference from Uniprot sequence cloning artifact:engineered mutation
Mutations (UniProt numbering) G25A, C32G
Insertions None
Deletions M1-Y24
Sequence identity to UniProt 0.9820
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006r6n , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 25-135 (26-135), 0.82
Difference from Uniprot sequence cloning artifact:engineered mutation
Mutations (UniProt numbering) G25A, C32M
Insertions None
Deletions M1-Y24
Sequence identity to UniProt 0.9820
auth_asym_id A
label_asym_ids of heme C
Available structure PDB