Danish
Uniprot ID:  Q30JB5
  • Protein: Cytochrome c-552 Ks_3358
  • Organism: Kuenenia stuttgartiensis
  • Length: 115
  • Sequence:
    • MKNKNTLTLALFSVTIGASAFFFGTSVSKASNIDGMKLYLQHCKTCHGVDGNPTDLGEGLGARKFADAEWQAKTSDERIIEQINEGTPEMMMPFKEKLTPEEVKALVPVVRGFKK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00005mxy , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 33-115 (31-115), 0.74
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A30
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005mxz , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 33-114 (31-115), 0.74
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y39F
Insertions None
Deletions M1-A30
Sequence identity to UniProt 0.9882
auth_asym_id A
label_asym_ids of heme B
Available structure PDB