Danish
Uniprot ID:  Q30WH0
  • Protein: Cytochrome c class III
  • Organism: Desulfovibrio alaskensis (Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20))
  • Length: 130
  • Sequence:
    • MRKSLFAVMVLALVAAFALPVIAAEAPADGLKMENTKMPVIFNHSSHSSYQCADCHHPVDGKENLAKCATAGCHDVFDKKDKSVHSYYKIIHDRKATTVATCMSCHLEAAGSDKDLKKELTGCKKSKCHP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002a3m , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-107 (1-130), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00002a3p , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-107 (1-130), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB