Danish
Uniprot ID:  Q3AB29
  • Protein: Carbon monoxide oxidation system transcription regulator CooA-1
  • Organism: Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
  • Length: 217
  • Sequence:
    • MRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKNSLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSSGV
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00002fmy , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 2-219 (1-217), 1.00
Mutations (UniProt numbering) None
Insertions 0insATQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00002fmy , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1002-1219 (1-217), 1.00
Mutations (UniProt numbering) None
Insertions 0insATQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002fmy , Chain C 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 2002-2219 (1-217), 1.00
Mutations (UniProt numbering) None
Insertions 0insATQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00002fmy , Chain D 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 3002-3219 (1-217), 1.00
Mutations (UniProt numbering) None
Insertions 0insATQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00002hkx , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 2-219 (1-217), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) N123L, S124L
Insertions 0insMATQ
Deletions None
Sequence identity to UniProt 0.9908
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002hkx , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 2-149 (1-217), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) N123L, S124L
Insertions 0insMATQ
Deletions None
Sequence identity to UniProt 0.9908
auth_asym_id B
label_asym_ids of heme None
Available structure PDB