Danish
Uniprot ID:  Q3IY10
  • Protein: Cytochrome b
  • Organism: Rhodobacter sphaeroides (Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.))
  • Length: 445
  • Sequence:
    • MSGIPHDHYEPRTGIEKWLHSRLPIVALAYDTIMIPTPRNLNWMWIWGVVLAFCLVLQIVTGIVLAMHYTPHVDLAFASVEHIMRNVNGGFMLRYLHANGASLFFIAVYLHIFRGLYYGSYKAPREVTWIVGMLIYLAMMATAFMGYVLPWGQMSFWGATVITGLFGAIPGIGHSIQTWLLGGPAVDNATLNRFFSLHYLLPFVIAALVAIHIWAFHSTGNNNPTGVEVRRTSKAEAQKDTVPFWPYFIIKDVFALAVVLLVFFAIVGFMPNYLGHPDNYIEANPLSTPAHIVPEWYFLPFYAILRAFTADVWVVQIANFISFGIIDAKFFGVLAMFGAILVMALVPWLDTSPVRSGRYRPMFKIYFWLLAADFVILTWVGAQQTTFPYDWISLIASAYWFAYFLVILPILGAIEKPVAPPATIEEDFNAHYSPATGGTKTVVAE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  12
PDB ID:  pdb_00006nhh , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 3-432 (1-445), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme H ,  G
Available structure PDB
PDB ID:  pdb_00006nhh , Chain D 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 3-432 (1-445), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme R ,  Q
Available structure PDB
PDB ID:  pdb_00006nin , Chain A 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 3-430 (1-445), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A185C
Insertions None
Deletions None
Sequence identity to UniProt 0.9978
auth_asym_id A
label_asym_ids of heme T ,  S
Available structure PDB
PDB ID:  pdb_00006nin , Chain D 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 3-430 (1-445), 1.00
Mutations (UniProt numbering) A185C
Insertions None
Deletions None
Sequence identity to UniProt 0.9978
auth_asym_id E
label_asym_ids of heme BA ,  AA
Available structure PDB
PDB ID:  pdb_00006nin , Chain G 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 3-430 (1-445), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A185C
Insertions None
Deletions None
Sequence identity to UniProt 0.9978
auth_asym_id K
label_asym_ids of heme JA ,  IA
Available structure PDB
PDB ID:  pdb_00006nin , Chain J 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 3-430 (1-445), 1.00
Mutations (UniProt numbering) A185C
Insertions None
Deletions None
Sequence identity to UniProt 0.9978
auth_asym_id O
label_asym_ids of heme QA ,  PA
Available structure PDB
PDB ID:  pdb_00006nin , Chain M 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 3-430 (1-445), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A185C
Insertions None
Deletions None
Sequence identity to UniProt 0.9978
auth_asym_id S
label_asym_ids of heme XA ,  WA
Available structure PDB
PDB ID:  pdb_00006nin , Chain P 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 3-430 (1-445), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A185C
Insertions None
Deletions None
Sequence identity to UniProt 0.9978
auth_asym_id W
label_asym_ids of heme EB ,  DB
Available structure PDB
PDB ID:  pdb_00008asi , Chain B 
Residue indices (Uniprot), coverage 1-433 (1-445), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme M ,  L
Available structure PDB
PDB ID:  pdb_00008asi , Chain F 
Residue indices (Uniprot), coverage 1-432 (1-445), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme W ,  V
Available structure PDB
PDB ID:  pdb_00008asj , Chain B 
Residue indices (Uniprot), coverage 1-433 (1-445), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme L ,  K
Available structure PDB
PDB ID:  pdb_00008asj , Chain F 
Residue indices (Uniprot), coverage 1-432 (1-445), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme W ,  V
Available structure PDB