Danish

Uniprot ID: Q3IY10

Protein: Cytochrome b
Organism: Rhodobacter sphaeroides (Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.))
Length: 445
Sequence:

MSGIPHDHYEPRTGIEKWLHSRLPIVALAYDTIMIPTPRNLNWMWIWGVVLAFCLVLQIVTGIVLAMHYTPHVDLAFASVEHIMRNVNGGFMLRYLHANGASLFFIAVYLHIFRGLYYGSYKAPREVTWIVGMLIYLAMMATAFMGYVLPWGQMSFWGATVITGLFGAIPGIGHSIQTWLLGGPAVDNATLNRFFSLHYLLPFVIAALVAIHIWAFHSTGNNNPTGVEVRRTSKAEAQKDTVPFWPYFIIKDVFALAVVLLVFFAIVGFMPNYLGHPDNYIEANPLSTPAHIVPEWYFLPFYAILRAFTADVWVVQIANFISFGIIDAKFFGVLAMFGAILVMALVPWLDTSPVRSGRYRPMFKIYFWLLAADFVILTWVGAQQTTFPYDWISLIASAYWFAYFLVILPILGAIEKPVAPPATIEEDFNAHYSPATGGTKTVVAE

Number of chains: 12

PDB ID: 6nhh , Chain A
Resolution	3.00 Å
Residue indices (Uniprot), coverage	3-432 (1-445), 1.00
auth_asym_id	A
label_asym_ids of heme	G , H
Available structure	PDB

PDB ID: 6nhh , Chain D
Resolution	3.00 Å
Residue indices (Uniprot), coverage	3-432 (1-445), 1.00
auth_asym_id	E
label_asym_ids of heme	Q , R
Available structure	PDB

PDB ID: 6nin , Chain A
Resolution	3.60 Å
Residue indices (Uniprot), coverage	3-430 (1-445), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	S , T
Available structure	PDB

PDB ID: 6nin , Chain D
Resolution	3.60 Å
Residue indices (Uniprot), coverage	3-430 (1-445), 1.00
auth_asym_id	E
label_asym_ids of heme	AA , BA
Available structure	PDB

PDB ID: 6nin , Chain G
Resolution	3.60 Å
Residue indices (Uniprot), coverage	3-430 (1-445), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	K
label_asym_ids of heme	IA , JA
Available structure	PDB

PDB ID: 6nin , Chain J
Resolution	3.60 Å
Residue indices (Uniprot), coverage	3-430 (1-445), 1.00
auth_asym_id	O
label_asym_ids of heme	PA , QA
Available structure	PDB

PDB ID: 6nin , Chain M
Resolution	3.60 Å
Residue indices (Uniprot), coverage	3-430 (1-445), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	S
label_asym_ids of heme	WA , XA
Available structure	PDB

PDB ID: 6nin , Chain P
Resolution	3.60 Å
Residue indices (Uniprot), coverage	3-430 (1-445), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	W
label_asym_ids of heme	DB , EB
Available structure	PDB

PDB ID: 8asi , Chain B
Residue indices (Uniprot), coverage	1-433 (1-445), 1.00
auth_asym_id	B
label_asym_ids of heme	L , M
Available structure	PDB

PDB ID: 8asi , Chain F
Residue indices (Uniprot), coverage	1-432 (1-445), 1.00
auth_asym_id	F
label_asym_ids of heme	V , W
Available structure	PDB

PDB ID: 8asj , Chain B
Residue indices (Uniprot), coverage	1-433 (1-445), 1.00
auth_asym_id	B
label_asym_ids of heme	K , L
Available structure	PDB

PDB ID: 8asj , Chain F
Residue indices (Uniprot), coverage	1-432 (1-445), 1.00
auth_asym_id	F
label_asym_ids of heme	V , W
Available structure	PDB