Danish
Uniprot ID:  Q3IY11
  • Protein: Cytochrome c1
  • Organism: Rhodobacter sphaeroides (Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.))
  • Length: 285
  • Sequence:
    • MIRKLTLTAATALALSGGAAMAAGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVKGKKKTNV
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  12
PDB ID:  pdb_00006nhh , Chain B 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-256 (23-285), 0.92
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 285insGTGHHHHHH
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00006nhh , Chain E 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-256 (23-285), 0.92
Mutations (UniProt numbering) None
Insertions 285insGTGHHHHHH
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme V
Available structure PDB
PDB ID:  pdb_00006nin , Chain B 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 1-256 (23-285), 0.92
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 285insGTGHHHHHH
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme W
Available structure PDB
PDB ID:  pdb_00006nin , Chain E 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 1-256 (23-285), 0.92
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions 285insGTGHHHHHH
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme EA
Available structure PDB
PDB ID:  pdb_00006nin , Chain H 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 1-256 (23-285), 0.92
Mutations (UniProt numbering) None
Insertions 285insGTGHHHHHH
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id L
label_asym_ids of heme LA
Available structure PDB
PDB ID:  pdb_00006nin , Chain K 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 1-256 (23-285), 0.92
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions 285insGTGHHHHHH
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id P
label_asym_ids of heme SA
Available structure PDB
PDB ID:  pdb_00006nin , Chain N 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 1-256 (23-285), 0.92
Mutations (UniProt numbering) None
Insertions 285insGTGHHHHHH
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id T
label_asym_ids of heme ZA
Available structure PDB
PDB ID:  pdb_00006nin , Chain Q 
Resolution 3.60 Å
Residue indices (Uniprot), coverage 1-256 (23-285), 0.92
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions 285insGTGHHHHHH
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id X
label_asym_ids of heme HB
Available structure PDB
PDB ID:  pdb_00008asi , Chain C 
Residue indices (Uniprot), coverage 25-278 (1-285), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00008asi , Chain G 
Residue indices (Uniprot), coverage 25-278 (1-285), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id G
label_asym_ids of heme CA
Available structure PDB
PDB ID:  pdb_00008asj , Chain C 
Residue indices (Uniprot), coverage 25-278 (1-285), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00008asj , Chain G 
Residue indices (Uniprot), coverage 25-278 (1-285), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id G
label_asym_ids of heme CA
Available structure PDB