Danish

Uniprot ID: Q3IY11

Protein: Cytochrome c1
Organism: Rhodobacter sphaeroides (Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.))
Length: 285
Sequence:

MIRKLTLTAATALALSGGAAMAAGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVKGKKKTNV

Number of chains: 12

PDB ID: 6nhh , Chain B
Resolution	3.00 Å
Residue indices (Uniprot), coverage	1-256 (23-285), 0.92
Difference from Uniprot sequence	expression tag
auth_asym_id	B
label_asym_ids of heme	N
Available structure	PDB

PDB ID: 6nhh , Chain E
Resolution	3.00 Å
Residue indices (Uniprot), coverage	1-256 (23-285), 0.92
auth_asym_id	F
label_asym_ids of heme	V
Available structure	PDB

PDB ID: 6nin , Chain B
Resolution	3.60 Å
Residue indices (Uniprot), coverage	1-256 (23-285), 0.92
Difference from Uniprot sequence	expression tag
auth_asym_id	B
label_asym_ids of heme	W
Available structure	PDB

PDB ID: 6nin , Chain E
Resolution	3.60 Å
Residue indices (Uniprot), coverage	1-256 (23-285), 0.92
Difference from Uniprot sequence	engineered mutation
auth_asym_id	F
label_asym_ids of heme	EA
Available structure	PDB

PDB ID: 6nin , Chain H
Resolution	3.60 Å
Residue indices (Uniprot), coverage	1-256 (23-285), 0.92
auth_asym_id	L
label_asym_ids of heme	LA
Available structure	PDB

PDB ID: 6nin , Chain K
Resolution	3.60 Å
Residue indices (Uniprot), coverage	1-256 (23-285), 0.92
Difference from Uniprot sequence	engineered mutation
auth_asym_id	P
label_asym_ids of heme	SA
Available structure	PDB

PDB ID: 6nin , Chain N
Resolution	3.60 Å
Residue indices (Uniprot), coverage	1-256 (23-285), 0.92
auth_asym_id	T
label_asym_ids of heme	ZA
Available structure	PDB

PDB ID: 6nin , Chain Q
Resolution	3.60 Å
Residue indices (Uniprot), coverage	1-256 (23-285), 0.92
Difference from Uniprot sequence	engineered mutation
auth_asym_id	X
label_asym_ids of heme	HB
Available structure	PDB

PDB ID: 8asi , Chain C
Residue indices (Uniprot), coverage	25-278 (1-285), 1.00
auth_asym_id	C
label_asym_ids of heme	S
Available structure	PDB

PDB ID: 8asi , Chain G
Residue indices (Uniprot), coverage	25-278 (1-285), 1.00
auth_asym_id	G
label_asym_ids of heme	CA
Available structure	PDB

PDB ID: 8asj , Chain C
Residue indices (Uniprot), coverage	25-278 (1-285), 1.00
auth_asym_id	C
label_asym_ids of heme	S
Available structure	PDB

PDB ID: 8asj , Chain G
Residue indices (Uniprot), coverage	25-278 (1-285), 1.00
auth_asym_id	G
label_asym_ids of heme	CA
Available structure	PDB