Danish
Uniprot ID:  Q3J4W3
  • Protein: DHC, diheme cytochrome c
  • Organism: Rhodobacter sphaeroides (Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.))
  • Length: 161
  • Sequence:
    • MTLRILALALCLLPAGWTATYADDDGEHGGRRAALVVTDPLTRTECSACHMAYPAALLPARSWTALMADLPNHFGEDASLDEASRGQIESYLVANAADSSGAGRALRGLVQTDTPLRISELPWFKRKHADEVSPRMLEKARSMSNCAACHTGAERGLFDDD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002fwt , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 13-136 (34-158), 0.78
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A33, D159-D161
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 80ALA-91ASP
Structural gaps Exists
label_asym_ids of heme C ,  B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00002fw5 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 12-136 (23-161), 0.86
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C ,  B
Available structure PDB