Danish
Uniprot ID:  Q4G380
  • Protein: Cytochrome b559 subunit alpha
  • Organism: Coccolithophore (Emiliania huxleyi)
  • Length: 84
  • Sequence:
    • MSGGSTGERPFSDIITSIRYWIIHSITIPSLFVAGFLFVSTGLAYDAFGTPRPNEYFTQDRQQIPLVNDRFSAKQELEDLTKGL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00009kqb , Chain F 
Residue indices (Uniprot), coverage 16-81 (3-84), 0.98
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S2
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme UD
Available structure PDB
PDB ID:  pdb_00009kqb , Chain T 
Residue indices (Uniprot), coverage 16-81 (3-84), 0.98
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S2
Sequence identity to UniProt 1.0000
auth_asym_id e
label_asym_ids of heme ZF
Available structure PDB