Danish
Uniprot ID:  Q4K5N8
  • Protein: Heme acquisition protein HasAp
  • Organism: Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
  • Length: 205
  • Sequence:
    • MSISISYSATYGGNTVAQYLTDWSAYFGDVNHRPGEVVDGTNTGGFNPGPFDGTQYAIKSTASDAAFVADGNLHYTLFSNPSHTLWGSVDTISLGDTLAGGSGSNYNLVSQEVSFTNLGLNSLKEEGRAGEVHKVVYGLMSGDSSALAGEIDALLKAIDPSLSVNSTFDDLAAAGVAHVNPAAAAAADVGLVGVQDVAQDWALAA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00008ki1 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-181 (1-183), 0.89
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGS
Deletions A182-L203
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00008ki1 , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-181 (1-183), 0.89
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGS
Deletions A182-L203
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB