Danish
Uniprot ID:  Q4Q3K2
  • Protein: NAD(P)H oxidase
  • Organism: Leishmania major
  • Length: 303
  • Sequence:
    • MSGTSRRAKGLFTGIAVGTFVSGAMFVSCASARVEEPPFDIRALRADIEDMISEKLELGPSLIRLAWHEAASYDCFKKDGSPNSASMRFKPECLYAGNKGLDIPRKALETLKKKYPQISYADLWVLAAYVAIEYMGGPTIPFCWGRVDAKDGSVCGPDGRLPDGSKTQSHVREVFRRLGFNDQETVALIGAHTCGECHIEFSGYHGPWTHDKNGFDNSFFTQLLDEDWVLNPKVEQMQLMDRATTKLMMLPSDVCLLLDPSYRKYVELYAKDNDRFNKDFANAFKKLTELGTRNLHKAPASES
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  11
PDB ID:  pdb_00005al9 , Chain A 
Resolution 1.37 Å
Residue indices (Uniprot), coverage 34-300 (35-303), 0.89
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V34S, D211R
Insertions None
Deletions M1-R33
Sequence identity to UniProt 0.9926
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005al9 , Chain A-1 
Resolution 1.37 Å
Residue indices (Uniprot), coverage 34-300 (35-303), 0.89
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V34S, D211R
Insertions None
Deletions M1-R33
Sequence identity to UniProt 0.9926
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00003riv , Chain A 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 34-300 (35-303), 0.89
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1T
Insertions None
Deletions G3-V34
Sequence identity to UniProt 0.9963
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003riv , Chain B 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 34-298 (35-303), 0.89
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1T
Insertions None
Deletions G3-V34
Sequence identity to UniProt 0.9963
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00004ged , Chain A 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 34-301 (35-301), 0.88
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) V34S
Insertions None
Deletions M1-R33, S301-E302
Sequence identity to UniProt 0.9963
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005amm , Chain A 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 34-300 (35-303), 0.89
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V34S, D211N
Insertions None
Deletions M1-R33
Sequence identity to UniProt 0.9926
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005amm , Chain B 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 34-300 (35-303), 0.89
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V34S, D211N
Insertions None
Deletions M1-R33
Sequence identity to UniProt 0.9926
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003riw , Chain A 
Resolution 2.37 Å
Residue indices (Uniprot), coverage 34-300 (35-303), 0.89
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) M1T, C197T
Insertions None
Deletions G3-V34
Sequence identity to UniProt 0.9926
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003riw , Chain B 
Resolution 2.37 Å
Residue indices (Uniprot), coverage 33-300 (35-303), 0.89
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) M1T, C197T
Insertions None
Deletions G3-V34
Sequence identity to UniProt 0.9926
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00005ala , Chain A 
Resolution 2.73 Å
Residue indices (Uniprot), coverage 34-300 (35-303), 0.89
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V34S, D211R
Insertions None
Deletions M1-R33
Sequence identity to UniProt 0.9926
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005ala , Chain B 
Resolution 2.73 Å
Residue indices (Uniprot), coverage 34-300 (35-303), 0.89
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) V34S, D211R
Insertions None
Deletions M1-R33
Sequence identity to UniProt 0.9926
auth_asym_id B
label_asym_ids of heme F
Available structure PDB