Danish
Uniprot ID:  Q4QEN5
  • Protein: Putative cytochrome c
  • Organism: Leishmania major
  • Length: 113
  • Sequence:
    • MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRPSGKVEGFTYSKANAESGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00004ged , Chain B 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 12-113 (1-113), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00004dy9 , Chain A 
Resolution 2.08 Å
Residue indices (Uniprot), coverage 6-113 (1-113), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB