- Protein: Cytochrome c55X
- Organism:
- Length: 119
- Sequence:
MNAPPDFRRAASHALWLALALTFACPLPGLADEHPDARRQAQLRHLLLQDCGSCHGLRLTGGLGPALTPEALRGKPRESLVATVLMGRPQTPMPPWAGLLSEDDAGWLVDRLIEGEIAP
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-88 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | L , M |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-88 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | C |
| label_asym_ids of heme | L , M |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-88 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | N , O |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-88 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | F |
| label_asym_ids of heme | N , O |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-83 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | D |
| label_asym_ids of heme | P , Q |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-88 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | J |
| label_asym_ids of heme | P , Q |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-88 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | E |
| label_asym_ids of heme | R , S |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-88 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | K |
| label_asym_ids of heme | R , S |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-88 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | G |
| label_asym_ids of heme | T |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-84 (32-119), 0.74 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | H |
| Structural gaps | Exists |
| label_asym_ids of heme | U , V |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.14 Å |