Danish
Uniprot ID:  Q51479
  • Protein: Cytochrome c55X
  • Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
  • Length: 119
  • Sequence:
    • MNAPPDFRRAASHALWLALALTFACPLPGLADEHPDARRQAQLRHLLLQDCGSCHGLRLTGGLGPALTPEALRGKPRESLVATVLMGRPQTPMPPWAGLLSEDDAGWLVDRLIEGEIAP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  11
PDB ID:  pdb_00006tp9 , Chain A 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-88 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id A
label_asym_ids of heme M ,  L
Available structure PDB
PDB ID:  pdb_00006tp9 , Chain B 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-88 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id B
label_asym_ids of heme O ,  N
Available structure PDB
PDB ID:  pdb_00006tp9 , Chain C 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-88 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id C
label_asym_ids of heme M ,  L
Available structure PDB
PDB ID:  pdb_00006tp9 , Chain D 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-83 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id D
label_asym_ids of heme Q ,  P
Available structure PDB
PDB ID:  pdb_00006tp9 , Chain E 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-88 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id E
label_asym_ids of heme S ,  R
Available structure PDB
PDB ID:  pdb_00006tp9 , Chain F 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-88 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id F
label_asym_ids of heme O ,  N
Available structure PDB
PDB ID:  pdb_00006tp9 , Chain G 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-88 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id G
label_asym_ids of heme T
Available structure PDB
PDB ID:  pdb_00006tp9 , Chain H 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-84 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id H
Missing residues 30GLY-31GLY
Structural gaps Exists
label_asym_ids of heme V ,  U
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00006tp9 , Chain I 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-88 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id J
label_asym_ids of heme Q ,  P
Available structure PDB
PDB ID:  pdb_00006tp9 , Chain J 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-88 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id K
label_asym_ids of heme S ,  R
Available structure PDB
PDB ID:  pdb_00006tp9 , Chain K 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-88 (32-119), 0.77
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) P28G, L30G, A31R, E102A
Insertions None
Deletions M1-L27
Sequence identity to UniProt 0.9565
auth_asym_id I
label_asym_ids of heme V ,  U
Available structure PDB