Danish

Uniprot ID: Q52369

Protein: Cytochrome c4
Organism: Pseudomonas stutzeri (Stutzerimonas stutzeri)
Length: 210
Sequence:

MNKVLVSLLLTLGITGMAHAAGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYLLKQLQDIKAGSTPGAPEGVGRKVLEMTGMLDPLSDQDLEDIAAYFSSQKGSVGYADPALAKQGEKLFRGGKLDQGMPACTGCHAPNGVGNDLAGFPKLGGQHAAYTAKQLTDFREGNRTNDGDTMIMRGVAAKLSNKDIEALSSYIQGLH

Number of chains: 10

PDB ID: 1m70 , Chain A
Resolution	1.25 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	A
label_asym_ids of heme	E , F
Available structure	PDB

PDB ID: 1m70 , Chain B
Resolution	1.25 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	B
label_asym_ids of heme	H , I
Available structure	PDB

PDB ID: 1m70 , Chain C
Resolution	1.25 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	C
label_asym_ids of heme	J , K
Available structure	PDB

PDB ID: 1m70 , Chain D
Resolution	1.25 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	D
label_asym_ids of heme	L , M
Available structure	PDB

PDB ID: 1m6z , Chain A
Resolution	1.35 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	A
label_asym_ids of heme	E , F
Available structure	PDB

PDB ID: 1m6z , Chain B
Resolution	1.35 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	B
label_asym_ids of heme	H , I
Available structure	PDB

PDB ID: 1m6z , Chain C
Resolution	1.35 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	C
label_asym_ids of heme	J , K
Available structure	PDB

PDB ID: 1m6z , Chain D
Resolution	1.35 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	D
label_asym_ids of heme	M , N
Available structure	PDB

PDB ID: 1etp , Chain A
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	A
label_asym_ids of heme	C , D
Available structure	PDB

PDB ID: 1etp , Chain B
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-190 (21-210), 0.90
auth_asym_id	B
label_asym_ids of heme	E , F
Available structure	PDB