Danish
Uniprot ID:  Q53TN4
  • Protein: Plasma membrane ascorbate-dependent reductase CYBRD1
  • Organism: Human (Homo sapiens)
  • Length: 286
  • Sequence:
    • MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGIAIIVYRLPWTWKCSKLLMKSIHAGLNAVAAILAIISVVAVFENHNVNNIANMYSLHSWVGLIAVICYLLQLLSGFSVFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00005zle , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-230 (1-286), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 286insVELVPR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C ,  B
Available structure PDB
PDB ID:  pdb_00005zle , Chain A-1 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-230 (1-286), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 286insVELVPR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1 ,  B-1
Available structure PDB
PDB ID:  pdb_00005zlg , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 6-230 (1-286), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 286insVELVPR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C ,  B
Available structure PDB
PDB ID:  pdb_00005zlg , Chain A-1 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 6-230 (1-286), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 286insVELVPR
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1 ,  B-1
Available structure PDB