Danish

Uniprot ID: Q57038

Protein: Cytochrome b6
Organism: Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Length: 222
Sequence:

MFSKEVTESKVFQWFNDRLEVQAISDDIASKYVPPHVNIFYCLGGLTLTCFLIQFATGFAMTFYYKPTVTEAFASVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVVGVMLAVTTVTFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDQLVTLMRGSESVGQATLTRFYSLHTFVLPWAIAVLLLLHFLMIRKQGISGPL

Number of chains: 4

PDB ID: pdb_00007r0w , Chain B
Residue indices (Uniprot), coverage	1-222 (1-222), 1.00
Mutations (UniProt numbering)	None
Insertions	None
Deletions	None
Sequence identity to UniProt	1.0000
auth_asym_id	I
label_asym_ids of heme	U , S
Available structure	PDB

PDB ID: pdb_00007r0w , Chain I
Residue indices (Uniprot), coverage	1-222 (1-222), 1.00
Mutations (UniProt numbering)	None
Insertions	None
Deletions	None
Sequence identity to UniProt	1.0000
auth_asym_id	A
label_asym_ids of heme	EA , DA
Available structure	PDB

PDB ID: pdb_00007zxy , Chain A
Residue indices (Uniprot), coverage	3-222 (1-222), 1.00
Mutations (UniProt numbering)	None
Insertions	None
Deletions	None
Sequence identity to UniProt	1.0000
auth_asym_id	A
label_asym_ids of heme	T , S , R
Available structure	PDB

PDB ID: pdb_00007zxy , Chain I
Residue indices (Uniprot), coverage	3-222 (1-222), 1.00
Mutations (UniProt numbering)	None
Insertions	None
Deletions	None
Sequence identity to UniProt	1.0000
auth_asym_id	I
label_asym_ids of heme	GA , FA , EA
Available structure	PDB