Danish
Uniprot ID:  Q57142
  • Protein: Cytochrome c-554
  • Organism: Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
  • Length: 235
  • Sequence:
    • MKIMIACGLVAAALFTLTSGQSLAADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDPAKDYTQDKDCVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAKAPYTPFTPEVDAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEFQASAKPAKKGK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00001ft5 , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-211 (25-235), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  F ,  G ,  H
Available structure PDB
PDB ID:  pdb_00001ft6 , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-208 (25-235), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G ,  F ,  E ,  D
Available structure PDB
PDB ID:  pdb_00001bvb , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 1-211 (25-235), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  F ,  G ,  H
Available structure PDB