Danish
Uniprot ID:  Q59452
  • Protein: Superoxide dismutase [Cu-Zn]
  • Organism: Haemophilus ducreyi (strain 35000HP / ATCC 700724)
  • Length: 199
  • Sequence:
    • MKLTKVALFSLGLFGFSSMALAHGDHMHNHDTKMDTMSKDMMSMEKIVVPVQQLDPQNGNKDVGTVEITESAYGLVFTPKLHDLAHGLHGFHIHEKPSCEPKEKDGKLVAGLGAGGHWDPKQTQKHGYPWSDDAHMGDLPALFVMHDGSATTPVLAPRLKKLAEVKGHSLMIHAGGDNHSDHPAPLGGGGPRMACGVIK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001z9n , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 23-177 (23-199), 0.89
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001z9n , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 23-177 (23-199), 0.89
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001z9n , Chain C 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 23-177 (23-199), 0.89
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00001z9n , Chain D 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 23-177 (23-199), 0.89
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme L
Available structure PDB