Danish
Uniprot ID:  Q5L1S0
  • Protein: Hypothetical conserved protein
  • Organism: Geobacillus kaustophilus (strain HTA426)
  • Length: 137
  • Sequence:
    • MGEQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPDDLTETARKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHLDRKEHTLE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002bkm , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 3-130 (3-130), 0.93
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) R48H
Insertions None
Deletions M1-G2, R131-E137
Sequence identity to UniProt 0.9922
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00002bkm , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 3-130 (3-130), 0.93
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) R48H
Insertions None
Deletions M1-G2, R131-E137
Sequence identity to UniProt 0.9922
auth_asym_id B
label_asym_ids of heme G
Available structure PDB