Danish
Uniprot ID:  Q66G68
  • Protein: Extracellular heme acquisition hemophore HasA
  • Organism: Yersinia pseudotuberculosis serotype I (strain IP32953)
  • Length: 205
  • Sequence:
    • MSTTIQYNSNYADYSISSYLREWANNFGDIDQAPAETKDRGSFSGSSTLFSGTQYAIGSSHSNPEGMIAEGDLKYSFMPQHTFHGQIDTLQFGKDLATNAGGPSAGKHLEKIDITFNELDLSGEFDSGKSMTENHQGDMHKSVRGLMKGNPDPMLEVMKAKGINVDTAFKDLSIASQYPDSGYMSDAPMVDTVGVMDSNDMLLAA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  12
PDB ID:  pdb_00004xzd , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004xzd , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Mutations (UniProt numbering) None
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00004y4s , Chain A 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 1-182 (1-205), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id A
Missing residues 29ASP-44SER:127SER-137GLY
Structural gaps Exists
label_asym_ids of heme B-1 ,  B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004y4s , Chain A-1 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 1-182 (1-205), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id A
Missing residues 29ASP-44SER:127SER-137GLY
Structural gaps Exists
label_asym_ids of heme B-1 ,  B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004y1q , Chain A 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00004y1q , Chain B 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00004y1q , Chain C 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004y1q , Chain D 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id G
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00004y1q , Chain E 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id I
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00004y1q , Chain F 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id K
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00004y1q , Chain G 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id M
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00004y1q , Chain H 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 2-180 (1-205), 1.00
Mutations (UniProt numbering) Y75A
Insertions 0insMRGSHHHHHHGS
Deletions None
Sequence identity to UniProt 0.9951
auth_asym_id O
label_asym_ids of heme P
Available structure PDB