Danish
Uniprot ID:  Q67XG0
  • Protein: Two-on-two hemoglobin-3
  • Organism: Mouse-ear cress (Arabidopsis thaliana)
  • Length: 175
  • Sequence:
    • MQSLQDKASVLSGVDQAEAFAIDESNLFDKLGLQTFINLSTNFYTRVYDDEEEWFQSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDSVDIDQDSKIKMMKFFRHTAFFLVAGNELKNQNEKPKHKPQCACKHAANKPAEE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00004c0n , Chain A 
Resolution 1.77 Å
Residue indices (Uniprot), coverage 2-151 (1-175), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00004c0n , Chain A-1 
Resolution 1.77 Å
Residue indices (Uniprot), coverage 2-151 (1-175), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D-1
Available structure PDB
PDB ID:  pdb_00004c44 , Chain A 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 1-150 (1-175), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004c44 , Chain A-1 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 1-150 (1-175), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB