Danish
Uniprot ID:  Q6B0K9
  • Protein: Hemoglobin subunit mu
  • Organism: Human (Homo sapiens)
  • Length: 141
  • Sequence:
    • MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00009iux , Chain A 
Resolution 1.53 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C49S, C104S
Insertions None
Deletions None
Sequence identity to UniProt 0.9858
auth_asym_id A
Missing residues 48ALA-51ASP:62MET-62MET
Structural gaps Exists
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009iux , Chain A-1 
Resolution 1.53 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C49S, C104S
Insertions None
Deletions None
Sequence identity to UniProt 0.9858
auth_asym_id A
Missing residues 48ALA-51ASP:62MET-62MET
Structural gaps Exists
Nonstandard amino acids MHO Structure of MHOMHO
label_asym_ids of heme B-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å