- Protein: Catalase
- Organism: Yeast (Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37))
- Length: 511
- Sequence:
MGHPTNTADVRKDRVVTNSQGAPINEPFATQRVGQHGPLLLQDFNLLDSLAHFNRERIPERNPHAHGSGAFGYLEITDDITDVCGSAMFDTVGKRTRCLVRFSTVGGEKGSADTARDPRGFAIKFYSEEGNVDWVNNNTPVFFIRDPSKFPHFIHTQKRNPETNMKDADMFWDFLTTEENQVAIHQVMILFSDRGTPASYRNMNSYSGHTYKWSNKQGEWRYVQVHLKTDQGIKNLNNEEATKLAGENPDYCQKDLFENIAKGNYPSWTLYIQTMTEEEAEKLPFSVFDLTKVWPHKQFPLRRVGKMVLNENPENYFAQVEQAAFSPSHTVPYQEASADPVLQARLFSYPDAHRYRLGPNYSQIPVNCPYASKVFNPAIRDGPMNVNGNLGKEPNYLSTSKKYQFIQQSKPIQQHQEVWSGPAMPVHWATSPGDIDFVQARDLYNKVLSKQPGQQKALAHNVAVHVASACPEIQDRVFAMFARVDRGLSENIKKEALSLSPRKAAALNAKL
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | -3-502 (1-511), 1.00 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | E |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-502 (1-511), 1.00 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | B |
| label_asym_ids of heme | N |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-502 (1-511), 1.00 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | C |
| label_asym_ids of heme | S |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-503 (1-511), 1.00 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | D |
| label_asym_ids of heme | Y |
| Available structure | PDB |