Danish
Uniprot ID:  Q747J2
  • Protein: Cytochrome c, 1 heme-binding site
  • Organism: Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
  • Length: 150
  • Sequence:
    • MQKTTILSLVMGLLVAATAWGGEVTYRKDIKPIFDVRCAGCHGADAAPEYHAFKAEKEKWLAKGQGMRMDTYSHLIFYTAWPDTGALMRRLDDGKNSKDAKPGNMYRHLGATEEERQRNLAVFKAWVGVWNLKKWPDITKEELNAITVTY
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00004rlr , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-129 (22-150), 0.86
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G21
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 75ASN-77LYS
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.18 Å