Danish
Uniprot ID:  Q748S4
  • Protein: Cytochrome c
  • Organism: Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
  • Length: 94
  • Sequence:
    • MKLAKKDWFFIVLIVVVVGVFWAISGEVRTKKVPLDTNHKRFYDAFAQGAGKLDLDRQCVECHHEKPGGIPFPKNHPVKPADGPMRCLFCHKFK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002czs , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 28-97 (25-94), 0.77
Difference from Uniprot sequence cloning artifact:expression tag
Mutations (UniProt numbering) I24V
Insertions 94insLEHHHHHH
Deletions K2-A23
Sequence identity to UniProt 0.9861
auth_asym_id A
label_asym_ids of heme F ,  G
Available structure PDB
PDB ID:  pdb_00002czs , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 28-96 (25-94), 0.77
Difference from Uniprot sequence cloning artifact:expression tag
Mutations (UniProt numbering) I24V
Insertions 94insLEHHHHHH
Deletions K2-A23
Sequence identity to UniProt 0.9861
auth_asym_id B
label_asym_ids of heme K ,  L
Available structure PDB