Danish
Uniprot ID:  Q74AE4
  • Protein: Lipoprotein cytochrome c, 1 heme-binding site
  • Organism: Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
  • Length: 104
  • Sequence:
    • MRGLAPVAACMALALAAGCSGGSGAGGGELFATHCAGCHPQGGNTVHPEKTLARARREANGIRTVRDVAAYIRNPGPGMPAFGEAMIPPADALKIGEYVVASFP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00006u97 , Chain A 
Resolution 1.13 Å
Residue indices (Uniprot), coverage 23-104 (24-104), 0.79
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S23A, H47I
Insertions None
Deletions M1-G22
Sequence identity to UniProt 0.9756
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003cu4 , Chain A 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 26-104 (20-104), 0.82
Mutations (UniProt numbering) None
Insertions None
Deletions M1-C19
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003dp5 , Chain A 
Resolution 1.86 Å
Residue indices (Uniprot), coverage -20-104 (26-104), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1A, R2A, G3S, L4W, A5S, P6H, V7P, A8Q, A9F, C10E, M11K, A12G, L13A, A14E, L15T, A17V, G18P, C19N
Insertions None
Deletions G21-A25
Sequence identity to UniProt 0.8182
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005mcs , Chain A 
Residue indices (Uniprot), coverage 25-104 (25-104), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G24
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB