- Protein: Lipoprotein cytochrome c, 1 heme-binding site
- Organism:
- Length: 104
- Sequence:
MRGLAPVAACMALALAAGCSGGSGAGGGELFATHCAGCHPQGGNTVHPEKTLARARREANGIRTVRDVAAYIRNPGPGMPAFGEAMIPPADALKIGEYVVASFP
| Resolution | 1.13 Å |
|---|---|
| Residue indices (Uniprot), coverage | 23-104 (24-104), 0.78 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 26-104 (20-104), 0.82 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.86 Å |
|---|---|
| Residue indices (Uniprot), coverage | -20-104 (26-104), 0.76 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-104 (25-104), 0.77 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |