Danish
Uniprot ID:  Q74CB4
  • Protein: Cytochrome c
  • Organism: Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
  • Length: 90
  • Sequence:
    • MKRTVILFAAMILTASVGLAADVILFPSKNGAVTFTHKRHSEFVRECRSCHEKTPGKIRNFGKDYAHKTCKGCHEVRGAGPTKCKLCHTG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00003h34 , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-71 (21-90), 0.78
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D ,  C ,  B
Available structure PDB