Danish
Uniprot ID:  Q74FY6
  • Protein: Cytochrome c peroxidase
  • Organism: Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
  • Length: 346
  • Sequence:
    • MKTRNLAWGMALTLVAGVAWGKEDVMKRAQGLFKPIPAKPPVMKDNPASPSRVELGRMLFFDPRLSASHLISCNTCHNVGLGGTDILETSIGHGWQKGPRNSPTVLNAVYNIAQFWDGRAEDLAAQAKGPVQASVEMNNKPENLVATLKSIPGYPPLFRKAFPGQGDPVTFDNVAKAIEVFEATLVTPDAPFDKYLKGNRKAISSTAEQGLALFLDKGCAACHSGVNMGGTGYFPFGVREDPGPVVRPVDDTGRYKVTSTAADKYVFRSPSLRNVAITMPYFHSGKVWKLKDAVKIMGSAQLGISITDADADKIVTFLNTLTGAQPKVMHPVLPPNSDDTPRPVSN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00004aan , Chain A 
Resolution 1.22 Å
Residue indices (Uniprot), coverage 24-346 (23-346), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1W, K2S, T3H, R4P, N5Q, L6F, A7E, W8K, V15A, A16E, G17T, V18A, A19V, W20P, G21N, K22S
Insertions None
Deletions M10-L14
Sequence identity to UniProt 0.9531
auth_asym_id A
label_asym_ids of heme C ,  B
Available structure PDB
PDB ID:  pdb_00004aan , Chain A-1 
Resolution 1.22 Å
Residue indices (Uniprot), coverage 24-346 (23-346), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1W, K2S, T3H, R4P, N5Q, L6F, A7E, W8K, V15A, A16E, G17T, V18A, A19V, W20P, G21N, K22S
Insertions None
Deletions M10-L14
Sequence identity to UniProt 0.9531
auth_asym_id A
label_asym_ids of heme C-1 ,  B-1
Available structure PDB
PDB ID:  pdb_00004aal , Chain A 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 23-346 (23-346), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1W, K2S, T3H, R4P, N5Q, L6F, A7E, W8K, V15A, A16E, G17T, V18A, A19V, W20P, G21N, K22S
Insertions None
Deletions M10-L14
Sequence identity to UniProt 0.9531
auth_asym_id A
Missing residues 244PRO-247ARG
Structural gaps Exists
label_asym_ids of heme D ,  C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004aal , Chain B 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 23-346 (23-346), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1W, K2S, T3H, R4P, N5Q, L6F, A7E, W8K, V15A, A16E, G17T, V18A, A19V, W20P, G21N, K22S
Insertions None
Deletions M10-L14
Sequence identity to UniProt 0.9531
auth_asym_id B
Missing residues 244PRO-248PRO
Structural gaps Exists
label_asym_ids of heme V ,  U
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004aam , Chain A 
Resolution 2.17 Å
Residue indices (Uniprot), coverage 23-346 (23-346), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1W, K2S, T3H, R4P, N5Q, L6F, A7E, W8K, V15A, A16E, G17T, V18A, A19V, W20P, G21N, K22S
Insertions None
Deletions M10-L14
Sequence identity to UniProt 0.9531
auth_asym_id A
label_asym_ids of heme C ,  B
Available structure PDB
PDB ID:  pdb_00004aam , Chain A-1 
Resolution 2.17 Å
Residue indices (Uniprot), coverage 23-346 (23-346), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1W, K2S, T3H, R4P, N5Q, L6F, A7E, W8K, V15A, A16E, G17T, V18A, A19V, W20P, G21N, K22S
Insertions None
Deletions M10-L14
Sequence identity to UniProt 0.9531
auth_asym_id A
label_asym_ids of heme C-1 ,  B-1
Available structure PDB
PDB ID:  pdb_00004aao , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 23-346 (23-346), 0.99
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) M1W, K2S, T3H, R4P, N5Q, L6F, A7E, W8K, V15A, A16E, G17T, V18A, A19V, W20P, G21N, K22S, H93G
Insertions None
Deletions M10-L14
Sequence identity to UniProt 0.9501
auth_asym_id A
Missing residues 91ILE-97LYS:126GLN-126GLN:242PRO-254ARG
Structural gaps Exists
label_asym_ids of heme D ,  C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00004aao , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 23-345 (23-346), 0.99
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) M1W, K2S, T3H, R4P, N5Q, L6F, A7E, W8K, V15A, A16E, G17T, V18A, A19V, W20P, G21N, K22S, H93G
Insertions None
Deletions M10-L14
Sequence identity to UniProt 0.9501
auth_asym_id B
Missing residues 91ILE-97LYS:242PRO-252THR
Structural gaps Exists
label_asym_ids of heme M ,  L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.18 Å