Danish
Uniprot ID:  Q74G83
  • Protein: Cytochrome c
  • Organism: Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
  • Length: 91
  • Sequence:
    • MKKLIASLALTLFAAGAALAADTMTFTAKNGNVTFDHKKHQTIVPDCAVCHGKTPGKIEGFGKEMAHGKSCKGCHEEMKKGPTKCGECHKK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003bxu , Chain A 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-71 (21-91), 0.78
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F ,  E ,  D
Available structure PDB
PDB ID:  pdb_00003bxu , Chain B 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-71 (21-91), 0.78
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I ,  H ,  G
Available structure PDB