Danish
Uniprot ID:  Q7A649
  • Protein: Heme oxygenase (staphylobilin-producing) 1
  • Organism: Staphylococcus aureus (strain N315)
  • Length: 107
  • Sequence:
    • MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVITYDIGYSYMK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00002zdo , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 0-107 (1-107), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) N7A
Insertions 0insST
Deletions None
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00002zdo , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 0-107 (1-107), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) N7A
Insertions 0insST
Deletions None
Sequence identity to UniProt 0.9907
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002zdo , Chain C 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 0-107 (1-107), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) N7A
Insertions 0insST
Deletions None
Sequence identity to UniProt 0.9907
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002zdo , Chain D 
Resolution 1.80 Å
Residue indices (Uniprot), coverage -1-107 (1-107), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) N7A
Insertions 0insST
Deletions None
Sequence identity to UniProt 0.9907
auth_asym_id D
label_asym_ids of heme H
Available structure PDB