Danish
Uniprot ID:  Q7CX73
  • Protein: Globin
  • Organism: Agrobacterium tumefaciens (strain C58) (Agrobacterium fabrum (strain C58 / ATCC 33970))
  • Length: 133
  • Sequence:
    • MSSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADNP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002xyk , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-129 (1-133), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002xyk , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-130 (1-133), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB