Danish
Uniprot ID:  Q812Q3
  • Protein: Heme-degrading monooxygenase
  • Organism: Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
  • Length: 107
  • Sequence:
    • MIIVTNTAKITKGNGHKLIERFNKVGKVETMPGFLGLEVLLTQNTVDYDEVTISTRWNAKEDFQGWTKSAAFKDAHSHQGGMPEYILDNKIAYYDVKVVRMPMAAAQ
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00008avi , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (1-107), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00008avi , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-106 (1-107), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB