Danish
Uniprot ID:  Q8AYM1
  • Protein: Hemoglobin beta chain
  • Organism: Atlantic bluefin tuna (Thunnus thynnus)
  • Length: 147
  • Sequence:
    • MVEWTQQERSIIAGIFANLNYEDIGPKALARCLIVYPWTQRYFGAYGDLSTPDAIKGNAKIAAHGVKVLHGLDRAVKNMDNINEAYSELSVLHSDKLHVDPDNFRILGDCLTVVIAANLGDAFTVETQCAFQKFLAVVVFALGRKYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00001v4x , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 201-346 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001v4x , Chain D 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 601-746 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001v4w , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001v4w , Chain D 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001v4u , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-142 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001v4u , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-142 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme K
Available structure PDB