Danish
Uniprot ID:  Q8DHH0
  • Protein: Tlr1989 protein
  • Organism: Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
  • Length: 194
  • Sequence:
    • MVIQSFEVKKMTIEPINFMATMVRRVQLTDEDKSLLAEAAPWGKEIAPQMADTFYDYLGRDEEMNAILNATEGRIHRLHQTFVDWFYEMFTGMDSWGKAYAERRWKIGLVHVRIGIGPQHVVPAMAVVVNAVRQKLREANKSEALSDALGKICMIDLAFIEQAYFEVSSQAVLKETGWTQALFQRLIATGAAAM
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00008h17 , Chain A 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 13-169 (1-194), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB