Danish
Uniprot ID:  Q8DJE2
  • Protein: Cytochrome c-550-like protein
  • Organism: Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
  • Length: 175
  • Sequence:
    • MYQPHFWQRSIGWLCGGLLILLLGWTIAPATALAAAGVDNYVIQYLKVTDTVELPVNDRGETKTFTAVDLTRGKRLFEENCKNCHVGGSTLPNPLVSLSLKDLKGATPPRDTIASLVAFQRSPKSYDGSEESYSCRRVSEDWLTTEQLETLAAFILRAAAVAPGWGVESFPDSAP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00004lji , Chain A 
Resolution 1.51 Å
Residue indices (Uniprot), coverage 2-134 (35-175), 0.81
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A34
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004lji , Chain B 
Resolution 1.51 Å
Residue indices (Uniprot), coverage 3-133 (35-175), 0.81
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A34
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB