Danish
Uniprot ID:  Q8E972
  • Protein: Tryptophan 2,3-dioxygenase KynA
  • Organism: Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
  • Length: 392
  • Sequence:
    • MKPATYNTEAFDEWIRSRFVELNSQLEQLYYQQTDRANVQEVGTELKHTLESEGRELVKALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPTRETTSPLLEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPDEKLFVDYNTKGILAYKRASDALLKIQPLGISHPISHDLLRVTKQALQDVIESNQQLFNRLDTDRFFYCVRPYYKPYRVGSVVYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQILRECMRRPNLMDDFLQAKGCIHQDWYQENLKLFIEVCELHGQTAIQHHNELVTKYIAEPSVSMEQQHLAKVTASGPPLHVLLASLERLRDRRAAVLRDDIRTRYYDLKKLKDSLR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00002nwb , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 5-396 (1-392), 1.00
Difference from Uniprot sequence cloning artifact
Mutations (UniProt numbering) None
Insertions 392insLEHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 341GLU-353PRO
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00002nwb , Chain A-1 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 5-396 (1-392), 1.00
Difference from Uniprot sequence cloning artifact
Mutations (UniProt numbering) None
Insertions 392insLEHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 341GLU-353PRO
Structural gaps Exists
label_asym_ids of heme C-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00002nwb , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 6-394 (1-392), 1.00
Difference from Uniprot sequence cloning artifact
Mutations (UniProt numbering) None
Insertions 392insLEHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Structural gaps Exists
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00002nwb , Chain B-1 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 6-394 (1-392), 1.00
Difference from Uniprot sequence cloning artifact
Mutations (UniProt numbering) None
Insertions 392insLEHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Structural gaps Exists
label_asym_ids of heme None
Available structure PDB