Danish
Uniprot ID:  Q8EF24
  • Protein: Diheme cytochrome c5 peroxidase CcpA
  • Organism: Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
  • Length: 333
  • Sequence:
    • MTKLTAIAITLTAIFASSYAVAAEPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPRPVPFATGAK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003o5c , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 24-331 (23-333), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) I14A, F15H, A16H, S17H, S18H, Y19H, A20H, V21G, A22G
Insertions None
Deletions M1-A13
Sequence identity to UniProt 0.9719
auth_asym_id A
label_asym_ids of heme F ,  E
Available structure PDB
PDB ID:  pdb_00003o5c , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 24-330 (23-333), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) I14A, F15H, A16H, S17H, S18H, Y19H, A20H, V21G, A22G
Insertions None
Deletions M1-A13
Sequence identity to UniProt 0.9719
auth_asym_id B
label_asym_ids of heme I ,  H
Available structure PDB
PDB ID:  pdb_00003o5c , Chain C 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 24-328 (23-333), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) I14A, F15H, A16H, S17H, S18H, Y19H, A20H, V21G, A22G
Insertions None
Deletions M1-A13
Sequence identity to UniProt 0.9719
auth_asym_id C
Missing residues 33LYS-33LYS
Structural gaps Exists
label_asym_ids of heme L ,  K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00003o5c , Chain D 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 24-330 (23-333), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) I14A, F15H, A16H, S17H, S18H, Y19H, A20H, V21G, A22G
Insertions None
Deletions M1-A13
Sequence identity to UniProt 0.9719
auth_asym_id D
label_asym_ids of heme P ,  O
Available structure PDB