Danish
Uniprot ID:  Q8EF49
  • Protein: NO-binding heme-dependent sensor protein
  • Organism: Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
  • Length: 181
  • Sequence:
    • MKGIIFNVLEDMVVAQCGMSVWNELLEKHAPKDRVYVSAKSYAESELFSIVQDVAQRLNMPIQDVVKAFGQFLFNGLASRHTDVVDKFDDFTSLVMGIHDVIHLEVNKLYHEPSLPHINGQLLPNNQIALRYSSPRRLCFCAEGLLFGAAQHFQQKIQISHDTCMHTGADHCMLIIELQND
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  7
PDB ID:  pdb_00004u9b , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-180 (1-181), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 181insENLYFQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00004u99 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-187 (1-181), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Q154A, Q155A, K156A
Insertions 181insENLYFQ
Deletions None
Sequence identity to UniProt 0.9834
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004u99 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-186 (1-181), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Q154A, Q155A, K156A
Insertions 181insENLYFQ
Deletions None
Sequence identity to UniProt 0.9834
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00004u9g , Chain A 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 1-187 (1-181), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Q154A, Q155A, K156A
Insertions 181insENLYFQ
Deletions None
Sequence identity to UniProt 0.9834
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004u9g , Chain B 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 1-186 (1-181), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Q154A, Q155A, K156A
Insertions 181insENLYFQ
Deletions None
Sequence identity to UniProt 0.9834
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002kii , Chain A 
Residue indices (Uniprot), coverage 1-181 (1-181), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002kil , Chain A 
Residue indices (Uniprot), coverage 1-181 (1-181), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) H103G
Insertions None
Deletions None
Sequence identity to UniProt 0.9945
auth_asym_id A
label_asym_ids of heme None
Available structure PDB