Danish
Uniprot ID:  Q8KG93
  • Protein: Cytochrome c-555
  • Organism: Chlorobium tepidum (Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS))
  • Length: 108
  • Sequence:
    • MSRFVSAALVGAALLVSGNAFAYDAAAGKATYDASCATCHKTGMMGAPKVGDKAAWAPRIAQGMNTLVSKSIKGYKGTKGMMPAKGGNAKLTDAQVGNAVAYMVGQSK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00004j20 , Chain A 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 1-88 (22-108), 0.81
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F21S, A22T
Insertions None
Deletions M1-A20
Sequence identity to UniProt 0.9773
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00004j20 , Chain B 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 1-88 (22-108), 0.81
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F21S, A22T
Insertions None
Deletions M1-A20
Sequence identity to UniProt 0.9773
auth_asym_id B
label_asym_ids of heme M
Available structure PDB