Danish
Uniprot ID:  Q8KX15
  • Protein: Cytochrome c6
  • Organism: Agmenellum quadruplicatum (Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6))
  • Length: 115
  • Sequence:
    • MNKRLVQVIVFVMIVLLLVPLLATPAFGADLDQGAQIFEAHCAGCHLNGGNIVRRGKNLKKRAMAKNGYTSVEAIANLVTQGKGNMSAYGDKLSSEEIQAVSQYVLQQSQTDWKS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00004eie , Chain A 
Resolution 1.03 Å
Residue indices (Uniprot), coverage 4-85 (29-115), 0.76
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G28
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004eif , Chain A 
Resolution 1.04 Å
Residue indices (Uniprot), coverage 4-85 (29-115), 0.76
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) L78Q
Insertions None
Deletions M1-G28
Sequence identity to UniProt 0.9885
auth_asym_id A
label_asym_ids of heme B
Available structure PDB