Danish
Uniprot ID:  Q8RT58
  • Protein: Group 1 truncated hemoglobin
  • Organism: Agmenellum quadruplicatum (Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6))
  • Length: 124
  • Sequence:
    • MASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHRNDVLNR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00004max , Chain A 
Resolution 1.44 Å
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00004max , Chain B 
Resolution 1.44 Å
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00004max , Chain C 
Resolution 1.44 Å
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004l2m , Chain A 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004l2m , Chain B 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002ksc , Chain A 
Residue indices (Uniprot), coverage 2-124 (2-124), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB